GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
£0.00
StableLine Wound Cream - 100 Gm
StableLine Wound Cream - 100 Gm

StableLine Wound Cream - 100 Gm

Units in Stock 0
Notify me when product is back in stock
£2.60 inc. tax

STABLELINE WOUND CREAM

This antibacterial cream will help to soothe minor cuts, grazes and sores. Also useful against insect bites and stings.
StableLine offer a value range of horse care products covering every aspect of skin, coat and hoof management throughout the year.














How quickly will my order arrive?

Our aim is to dispatch all orders placed before 12 noon on the next working day (not inc bank holidays and weekends). Any orders placed after that time will be dispatched on the next available working day.

We will send you a notification email when your order has been dispatched. 

While we always try our best to dispatch every order following the above guidelines, during extremely busy periods dispatch times may increase by up to one day.

 

Product Code: STL0041
Brand: stableline
Product Condition: New
Updating Order Details
Please do not refresh or navigate away from the page!
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i